PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.010G181100.1
Common NameB456_010G181100, LOC105773558
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family G2-like
Protein Properties Length: 294aa    MW: 33253 Da    PI: 9.8706
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.010G181100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.31.7e-3371124255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         prlrWtp+LH++Fv+ave+LGG+++AtPk +l++m+vkgLt++hvkSHLQ+YR+
  Gorai.010G181100.1  71 PRLRWTPDLHQCFVHAVERLGGEDRATPKMVLQIMDVKGLTISHVKSHLQMYRS 124
                         8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.31567127IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-3267125IPR009057Homeodomain-like
SuperFamilySSF466891.56E-1569125IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-2571125IPR006447Myb domain, plants
PfamPF002496.9E-872123IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MKRVDVDSCW LKGCCSSSSS LDDSGGISVY SPSPSMMRVM RRCHHKDDNL QLPEISLKSP  60
IVRPYVRSKM PRLRWTPDLH QCFVHAVERL GGEDRATPKM VLQIMDVKGL TISHVKSHLQ  120
MYRSTKHEQM IQVTEAATAS RRNEKVSELM NCPQNQQFKD QVRPYNLGLG IEGMPSFTIF  180
RQPQWNGNKV SNQLSYRELT NKGSEQRSST SYIIFKDLLK SCTIPENREK LNVGQHGGAD  240
WKCNHQRLVH LGDHSQASDS SILRSLNSKL SQKMSRRGKA EGLNDVSLEL TLA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5784955e-63JX578495.1 Gossypium hirsutum clone NBRI_GE10535 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012451013.10.0PREDICTED: probable transcription factor KAN4 isoform X3
RefseqXP_012451012.10.0PREDICTED: probable transcription factor KAN4 isoform X3
RefseqXP_012451011.10.0PREDICTED: probable transcription factor KAN4 isoform X3
RefseqXP_012451009.10.0PREDICTED: uncharacterized protein LOC105773558 isoform X1
TrEMBLA0A0D2UGQ20.0A0A0D2UGQ2_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-33G2-like family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]